PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008852
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 320aa    MW: 34986.9 Da    PI: 8.352
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687563PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-32368PU_unrefplantGDBView CDS
gnl|UG|Lsa#S29957418PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-3953113363
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                 +a++cprCdstntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknk+sss
  Lsa008852  53 AAAVNCPRCDSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGTLRNIPVGGGSRKNKRSSS 113
                6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2349100IPR003851Zinc finger, Dof-type
PfamPF027017.7E-3455110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.00356110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDRPHWPPQE IVVKPMEEIV VPNTTNSSNN YNNLSKPSSS SSSLERRIRP QKAAAVNCPR  60
CDSTNTKFCY YNNYSLSQPR YFCKTCRRYW TEGGTLRNIP VGGGSRKNKR SSSSTTSSSL  120
TSVSKKLPDL IVPSAPTSVL SQNPRILHDH YGQDLNLGFP SANNFKNVSD FMQIPNFDAT  180
RNTNSSASTT SSITTTASAS AQLSALELLT GITARGTMNC LMPIPIPDSN SVYSQSGQLM  240
IPMPEFKIPS LSFSLDGMAS GGAYGNSLDD STDRRVLFPF EELKTNTSTT TLDEQHVAQD  300
RDQNGDSNGF WNGMMGGGSW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002262703.11e-104PREDICTED: dof zinc finger protein DOF4.6
TrEMBLA0A103XJE41e-146A0A103XJE4_CYNCS; Zinc finger, Dof-type (Fragment)
STRINGVIT_02s0025g02250.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-41Dof family protein